{"title":"Handmade Sweetness - Complete Collection - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eHandmade Sweetness by Heather Briggs of My Sew Quilty Life has her signature pastels with a mixture of flowers, little bows, ginghams and stripes.\u003c\/p\u003e","products":[{"product_id":"handmade-sweetness-ribbon-candy-powder-blue","title":"Handmade Sweetness - Ribbon Candy Powder Blue - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eNarrow stripe in blue, peach and off white by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.  Great for binding!\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57940149993854,"sku":"31798 22","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31798-22ribboncandypowderbluehandmadesweetnessmysewquiltylifeheatherbriggsmodauk3179822.jpg?v=1788094591"},{"product_id":"handmade-sweetness-ribbon-candy-pear","title":"Handmade Sweetness - Ribbon Candy Pear - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eNarrow stripe in green, peach and off white by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.  Great for binding!\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57940166836606,"sku":"31798 19","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31798-19ribboncandypearhandmadesweetnessmysewquiltylifeheatherbriggsmodauk3179819.jpg?v=1788094590"},{"product_id":"handmade-sweetness-ribbon-candy-petal","title":"Handmade Sweetness - Ribbon Candy Petal - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eNarrow stripe in peach, blue and off white by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.  Great for binding!\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57940172243326,"sku":"31798 16","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31798-16ribboncandypetalhandmadesweetnessmysewquiltylifeheatherbriggsmodauk3179816.jpg?v=1788094590"},{"product_id":"handmade-sweetness-checks-powder-blue","title":"Handmade Sweetness - Checks Powder Blue - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eGingham in blue on white by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.  Great for binding!\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57940176667006,"sku":"31797 23","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31797-23checkspowderbluehandmadesweetnessmysewquiltylifeheatherbriggsmodauk3179723.jpg?v=1788094591"},{"product_id":"handmade-sweetness-checks-pear","title":"Handmade Sweetness - Checks Pear - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eGingham in green on white by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.  Great for binding!\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57940221854078,"sku":"31797 19","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31797-19checkspearhandmadesweetnessmysewquiltylifeheatherbriggsmodauk3179719.jpg?v=1788094590"},{"product_id":"handmade-sweetness-checks-peach","title":"Handmade Sweetness - Checks Peach - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eGingham in peach on white by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.  Great for binding!\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57941052850558,"sku":"31797 17","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31797-17checkspeachhandmadesweetnessmysewquiltylifeheatherbriggsmodauk3179717.jpg?v=1788094591"},{"product_id":"handmade-sweetness-checks-butterscotch","title":"Handmade Sweetness - Checks Butterscotch - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eGingham in yellow on white by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.  Great for binding!\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57941053243774,"sku":"31797 13","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31797-13checksbutterscotchhandmadesweetnessmysewquiltylifeheatherbriggsmodauk3179713.jpg?v=1788094590"},{"product_id":"handmade-sweetness-penny-sky","title":"Handmade Sweetness - Penny Sky - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny geometric that cleverly mimics petals in light blue on white by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57941057929598,"sku":"31796 22","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31796-22pennyskyhandmadesweetnessmysewquiltylifeheatherbriggsmodauk3179622.jpg?v=1788094591"},{"product_id":"handmade-sweetness-penny-petal","title":"Handmade Sweetness - Penny Petal - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny geometric that cleverly mimics petals in peach on white by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57941871427966,"sku":"31796 16","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31796-16pennypetalhandmadesweetnessmysewquiltylifeheatherbriggsmodauk3179616.jpg?v=1788094590"},{"product_id":"handmade-sweetness-penny-butterscotch","title":"Handmade Sweetness - Penny Butterscotch - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny geometric that cleverly mimics petals in yellow by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57941885747582,"sku":"31796 14","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31796-14pennybutterscotchhandmadesweetnessmysewquiltylifeheatherbriggsmodauk3179614.jpg?v=1788094590"},{"product_id":"handmade-sweetness-confetti-porcelain-white","title":"Handmade Sweetness - Confetti Porcelain White - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny motif in white on off white, a great low volume by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57941886828926,"sku":"31795 41","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31795-41confettiporcelainwhitehandmadesweetnessmysewquiltylifeheatherbriggsmodauk3179541.jpg?v=1788094590"},{"product_id":"handmade-sweetness-confetti-powder-blue","title":"Handmade Sweetness - Confetti Powder Blue - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny motif in white on blue by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57941903475070,"sku":"31795 23","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31795-23confettipowderbluehandmadesweetnessmysewquiltylifeheatherbriggsmodauk3179523.jpg?v=1788094591"},{"product_id":"handmade-sweetness-fq","title":"Handmade Sweetness - Complete Fat Quarter Bundle - 32 Fat Quarters with 3 Free - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per bundle.  The full price will be £108.75 per bundle.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £78.75 per bundle) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eThis is a bundle of 32 fat quarters from\u003ca href=\"https:\/\/justsewnow.com\/collections\/handmade-sweetness-complete-collection\" title=\"Handmade Sweetness\"\u003e Handmade Sweetness\u003c\/a\u003e by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.  In this bundle there are 32 fat quarters with 3 free, meaning you pay for 29 and receive 32!\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57941903704446,"sku":"HS FQ","price":30.0,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/Handmade_Sweetness_My_Sew_Quilty_Life_Heather_Briggs_Moda_UK_Ireland.jpg?v=1788124698"},{"product_id":"handmade-sweetness-confetti-peach","title":"Handmade Sweetness - Confetti Peach - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny motif in white on peach orange by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942070264190,"sku":"31795 17","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31795-17_confetti_peach_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31795_17.jpg?v=1788115472"},{"product_id":"handmade-sweetness-confetti-butterscotch","title":"Handmade Sweetness - Confetti Butterscotch - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny motif in white on yellow by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942071640446,"sku":"31795 13","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31795-13_confetti_butterscotch_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31795_13.jpg?v=1788115473"},{"product_id":"handmade-sweetness-confetti-porcelain","title":"Handmade Sweetness - Confetti Porcelain - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny multi coloured motifs on off white by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942071705982,"sku":"31795 11","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31795-11_confetti_porcelain_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31795_11.jpg?v=1788115473"},{"product_id":"handmade-sweetness-posies-blush","title":"Handmade Sweetness - Posies Blush - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eSmall flowers on light peach pink by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942072459646,"sku":"31794 15","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31794-15_posies_blush_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31794_15.jpg?v=1788115473"},{"product_id":"handmade-sweetness-posies-sunshine","title":"Handmade Sweetness - Posies Sunshine - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eSmall flowers on yellow by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942073115006,"sku":"31794 12","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31794-12_posies_sunshine_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31794_12.jpg?v=1788115476"},{"product_id":"handmade-sweetness-posies-porcelain","title":"Handmade Sweetness - Posies Porcelain - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eSmall coloured flowers on off white by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942074851710,"sku":"31794 11","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31794-11_posies_porcelain_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31794_11.jpg?v=1788115475"},{"product_id":"handmade-sweetness-bows-powder-blue","title":"Handmade Sweetness - Bows Powder Blue - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny bows and flowers in white on blue by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942083502462,"sku":"31793 23","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31793-23_bows_powder_blue_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31793_23.jpg?v=1788115475"},{"product_id":"handmade-sweetness-bows-pear","title":"Handmade Sweetness - Bows Pear - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny bows and flowers in white on green by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942089957758,"sku":"31793 19","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31793-19_bows_pear_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31793_19.jpg?v=1788115474"},{"product_id":"handmade-sweetness-bows-peach","title":"Handmade Sweetness - Bows Peach - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny bows and flowers in white on green by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942092611966,"sku":"31793 17","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31793-17_bows_peach_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31793_17.jpg?v=1788115475"},{"product_id":"handmade-sweetness-bows-porcelain","title":"Handmade Sweetness - Bows Porcelain - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny coloured bows and flowers in white on peach orange by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942094250366,"sku":"31793 11","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31793-11_bows_porcelain_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31793_11.jpg?v=1788115474"},{"product_id":"handmade-sweetness-doily-sky","title":"Handmade Sweetness - Doily Sky - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eSmall scalloped-edged doilies in white with tiny flowers on light blue by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942095561086,"sku":"31792 22","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31792-22_doily_sky_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31792_22.jpg?v=1788115473"},{"product_id":"handmade-sweetness-doily-pear","title":"Handmade Sweetness - Doily Pear - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eSmall scalloped-edged doilies in white with tiny flowers on green by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942098575742,"sku":"31792 19","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31792-19_doily_pear_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31792_19.jpg?v=1788115473"},{"product_id":"handmade-sweetness-doily-petal","title":"Handmade Sweetness - Doily Petal - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eSmall scalloped-edged doilies in white with tiny flowers on peach pink by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942120366462,"sku":"31792 16","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31792-16_doily_petal_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31792_16.jpg?v=1788124700"},{"product_id":"handmade-sweetness-bitty-blossoms-sky","title":"Handmade Sweetness - Bitty Blossoms Sky - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny flowers on blue by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942121054590,"sku":"31791 22","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31791-22_bitty_blossoms_sky_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31791_22.jpg?v=1788124701"},{"product_id":"handmade-sweetness-bitty-blossoms-blush","title":"Handmade Sweetness - Bitty Blossoms Blush - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny flowers on light pink by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942121218430,"sku":"31791 15","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31791-15_bitty_blossoms_blush_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31791_15.jpg?v=1788124700"},{"product_id":"handmade-sweetness-bitty-blossoms-porcelain","title":"Handmade Sweetness - Bitty Blossoms Porcelain - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eTiny flowers on off white by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942121808254,"sku":"31791 11","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31791-11_bitty_blossoms_porcelain_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31791_11.jpg?v=1788124699"},{"product_id":"handmade-sweetness-vintage-blooms-sky","title":"Handmade Sweetness - Vintage Blooms Sky - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eLarge flowers on blue by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942122332542,"sku":"31790 22","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31790-22_vintage_blooms_sky_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31790_22.jpg?v=1788124698"},{"product_id":"handmade-sweetness-vintage-blooms-blush","title":"Handmade Sweetness - Vintage Blooms Blush - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eLarge flowers on light pink by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942122529150,"sku":"31790 15","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31790-15_vintage_blooms_blush_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31790_15.jpg?v=1788124701"},{"product_id":"handmade-sweetness-vintage-blooms-butter","title":"Handmade Sweetness - Vintage Blooms Butter - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eLarge flowers on yellow by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942123217278,"sku":"31790 12","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31790-12_vintage_blooms_butter_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31790_12.jpg?v=1788124702"},{"product_id":"handmade-sweetness-vintage-blooms-porcelain","title":"Handmade Sweetness - Vintage Blooms Porcelain - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per fat quarter.  The full price will be £3.75 per fat quarter.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £3.25 per fat quarter) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eLarge flowers on yellow by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003eFabric will be cut to a metric fat quarter unless otherwise requested.  Multiples will be cut to a continuous length (2 = 1\/2 metre, 3 = 3\/4m etc).  Width of fabric measures approx. 42\".\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942123282814,"sku":"31790 12","price":0.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31790-11_vintage_blooms_porcelain_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31790_11.jpg?v=1788124702"},{"product_id":"handmade-sweetness-panel","title":"Handmade Sweetness - Panel - PRE-ORDER DUE OCTOBER","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per panel.  The full price will be £13.50 per panel.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £10 per panel) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eThis fab cheater print of 12 different applique and patchwork blocks feature fabrics from the range by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942124167550,"sku":"31772 11","price":3.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/31772_11_quilt_blocks_36_x_44_handmade_sweetness_my_sew_quilty_life_heather_briggs_moda_uk_31772_11.jpg?v=1788124708"},{"product_id":"handmade-sweetness-complete-fat-eighth-bundle-32-fat-eighths-with-3-free-pre-order-due-october-copy","title":"Handmade Sweetness - Complete Fat Eighth Bundle - 32 Fat Eighths with 3 Free - PRE-ORDER DUE OCTOBER (Copy)","description":"\u003cp\u003eThis is a pre-order.  The price is a reservation price per bundle.  The full price will be £54.40 per bundle.  Once the fabric has arrived, you will be sent an invoice for the remaining balance (i.e. £39.40 per bundle) and it will be shipped when the invoice has cleared.\u003c\/p\u003e\n\u003cp\u003eThis is a bundle of 32 fat eighths from\u003ca href=\"https:\/\/justsewnow.com\/collections\/handmade-sweetness-complete-collection\" title=\"Handmade Sweetness\"\u003e Handmade Sweetness\u003c\/a\u003e by Heather Briggs of \u003ca href=\"https:\/\/justsewnow.com\/collections\/my-sew-quilty-life\" title=\"My Sew Quilty Life\"\u003eMy Sew Quilty Life\u003c\/a\u003e.  In this bundle there are 32 fat eighths 3 free, meaning you pay for 29 and receive 32!\u003c\/p\u003e\n\u003cp\u003ePlease note: if mixing pre-orders and current items in your order and the value of your pre-order (at full price) is less than £35, an additional postage charge for the pre-ordered items will be included on the invoice for the remaining balance.\u003c\/p\u003e","brand":"Just Sew Now","offers":[{"title":"Default Title","offer_id":57942140125566,"sku":"HS FE","price":15.0,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/files\/Handmade_Sweetness_My_Sew_Quilty_Life_Heather_Briggs_Moda_UK_Ireland.jpg?v=1788124698"}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0999\/2411\/5838\/collections\/Handmade_Sweetness_My_Sew_Quilty_Life_Heather_Briggs_Moda_UK_Ireland.jpg?v=1788130557","url":"https:\/\/justsewnow.com\/collections\/handmade-sweetness-complete-collection.oembed?page=2","provider":"Just Sew Now","version":"1.0","type":"link"}